Conus emaciatus M superfamily MMSK group conopeptide Ec3-IP01 mRNA, complete cds. (N02137) Nucleic Acid Card

General Information
Name Conus emaciatus M superfamily MMSK group conopeptide Ec3-IP01 mRNA, complete cds.
Organism Conus emaciatus
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgatgtataaattcggagtgttgttgaccatctgtctgc
ttctgtttccccttactgcagttcagctggatggagatca
acctgtcgacctacctgcattgcgtacgcaggactttgca
cctgaacatagtccctggtttaaccccgtcaaacggtgct
gctcgcggcactgctgggtatgcatcccttgttgcccgaa
tggatca
tga
Sequence translation MMYKFGVLLTICLLLFPLTAVQLDGDQPVDLPALRTQDFA
PEHSPWFNPVKRCCSRHCWVCIPCCPNGS

References

Internal links
Proteins Encoded Ec3-IP01 precursor

External links
Ncbi
GenBank JF510885

Tools