Conus gloriamaris M superfamily MMSK group conopeptide Gm+Ca3-WP04 mRNA, complete cds. (N02149) Nucleic Acid Card

General Information
Name Conus gloriamaris M superfamily MMSK group conopeptide Gm+Ca3-WP04 mRNA, complete cds.
Organism Conus gloriamaris
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagccttgttgaccatctgtctac
ttctgttttccctaactgctgttccgctggatggagatca
acatgcagaccaacctgcagagcgtctgcatgaccgcctt
ccaactgaaaatcatcccttatatgatcccgtcaaacggt
gttgcgatgattcggaatgcgactattcttgctggccttg
ctgtatgtttgga
taa
Sequence translation MMSKLGALLTICLLLFSLTAVPLDGDQHADQPAERLHDRL
PTENHPLYDPVKRCCDDSECDYSCWPCCMFG

References

Internal links
Proteins Encoded Gm3-WP04 precursor

External links
Ncbi
GenBank JF510902

Tools