Conus caracteristicus M superfamily MMSK group conopeptide Ca3-KP02 mRNA, complete cds. (N02155) Nucleic Acid Card

General Information
Name Conus caracteristicus M superfamily MMSK group conopeptide Ca3-KP02 mRNA, complete cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagccttgttgaccatctgtctac
ttctgttttccctaactgctgttccgctcgatggagatca
acatgcagaccaacctgcagagcgtctgcaggacgacatt
tcatctgaaaataatcccatgtttaattccatcagaagga
gagagcagaaccagttcaagtccttcacttcagtcaaact
tctggactctcgaggagaaaggtgttgcggcccgacggca
tgcttggcgggttgcaagccttgttgtgga
tga
Sequence translation MMSKLGALLTICLLLFSLTAVPLDGDQHADQPAERLQDDI
SSENNPMFNSIRRREQNQFKSFTSVKLLDSRGERCCGPTA
CLAGCKPCCG

References

Internal links
Proteins Encoded Ca3-KP02 precursor

External links
Ncbi
GenBank JF510911

Tools