Conus tessulatus M superfamily MMSK group conopeptide Ts3-IP03 mRNA, complete cds. (N02166) Nucleic Acid Card

General Information
Name Conus tessulatus M superfamily MMSK group conopeptide Ts3-IP03 mRNA, complete cds.
Organism Conus tessulatus
Organism Diet vermivorous
Organism Clade XVI
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgcctgc
ttctgtttccccttactgctgtttcgctggatggagatca
acctgcagaccttcctgcattgcgtgcgcaggactttgca
cctgagcgtagtccctggtttgatcccgtcagacggtgct
gctcgcaggattgcagggtatgcatcccttgttgcccaaa
t
tga
Sequence translation MMSKLGVLLTICLLLFPLTAVSLDGDQPADLPALRAQDFA
PERSPWFDPVRRCCSQDCRVCIPCCPN

References

Internal links
Proteins Encoded Ts3.1 precursor

External links
Ncbi
GenBank JF510929

Tools