Conus vitulinus M superfamily MMSK group conopeptide Vt3-KP05 mRNA, complete cds. (N02170) Nucleic Acid Card

General Information
Name Conus vitulinus M superfamily MMSK group conopeptide Vt3-KP05 mRNA, complete cds.
Organism Conus vitulinus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagccttgttgaccatctgtctac
ttctgttttcccttactgctgttccgctggatggagatca
acatgcagaccaacctgcagagcgtctgcaggacgacatt
tcatctgaacatcccatgtttgatgccgtcagaaggagag
agcagaaccagttcaagtccttcacttcagtcaaacttct
ggactctcgaggagaaaggtgttgcggcccgacggcatgc
ttggcgggttgcaagccttgttgtgga
tga
Sequence translation MMSKLGALLTICLLLFSLTAVPLDGDQHADQPAERLQDDI
SSEHPMFDAVRRREQNQFKSFTSVKLLDSRGERCCGPTAC
LAGCKPCCG

References

Internal links
Proteins Encoded Vt3-KP04 precursor

External links
Ncbi
GenBank JF510936

Tools