Conus caracteristicus M superfamily MMSK group conopeptide Ca3-IP02 mRNA, complete cds. (N02182) Nucleic Acid Card

General Information
Name Conus caracteristicus M superfamily MMSK group conopeptide Ca3-IP02 mRNA, complete cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgatgtccaaactgggagtcttgttgaccatctgtctgc
ttctgtttccaattactggtcttccgctggatgaagatca
acatgctgatctacctgcattgcgtgcgcaggcctttgaa
cctgagcatagtccctggtttgatcccgtccgacggtgct
gctcgcaggattgctcggtgtgcatcccttgttgcccaaa
c
tga
Sequence translation MMSKLGVLLTICLLLFPITGLPLDEDQHADLPALRAQAFE
PEHSPWFDPVRRCCSQDCSVCIPCCPN

References

Internal links
Proteins Encoded Ca3-IP02 precursor

External links
Ncbi
GenBank JF510955

Tools