Li1.1 precursor (LIVI_1) gene, partial cds. (N02210) Nucleic Acid Card

General Information
Name Li1.1 precursor (LIVI_1) gene, partial cds.
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
ct
gcagccgactacaaacggtctgactggatcgctcgggt
catcgatagttgctgcagcaatccaccctgtgcccatgta
cattgtcatcgaagacgctga
tgc
Sequence translation AADYKRSDWIARVIDSCCSNPPCAHVHCHRRR-

References
Chang,D. and Duda,T.F. Jr. (2012) Extensive and continuous duplication facilitates rapid evolution and diversification of gene families. Mol. Biol. Evol. 29:2019-2029

Internal links
Proteins Encoded Li1.1 precursor

External links
Ncbi
GenBank JF723404

Tools