Li1.7 precursor (LIVI_17) gene, partial cds. (N02218) Nucleic Acid Card

General Information
Name Li1.7 precursor (LIVI_17) gene, partial cds.
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
cc
gcagccaacaacaaagcgactgacctgatggctctgac
tgtcaggggatgctgtgatgatcctccctgtagagcccga
tacccatttctttgtatttga
agacgctgatgct
Sequence translation AANNKATDLMALTVRGCCDDPPCRARYPFLCI-

References
Chang,D. and Duda,T.F. Jr. (2012) Extensive and continuous duplication facilitates rapid evolution and diversification of gene families. Mol. Biol. Evol. 29:2019-2029

Internal links
Proteins Encoded Li1.7 precursor

External links
Ncbi
GenBank JF723412

Tools