Vi23a (Vi23.1) precursor, mRNA, partial cds (N02291) Nucleic Acid Card

General Information
Name Vi23a (Vi23.1) precursor, mRNA, partial cds
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
c
gtactagttgtcatgacagctgcctctgcttcaggggat
gcactgacagaagccaagaggatcccttactgtggacaga
caggggcagaatgttattcttggtgtataaagcaggactt
atccaaagactggtgttgtgatttcgtcaagactatagct
cggttgccgccggctcacatatgttcacaatga
ttgctgt
tccatgccttggaattcgag
Sequence translation VLVVMTAASASGDALTEAKRIPYCGQTGAECYSWCIKQDL
SKDWCCDFVKTIARLPPAHICSQ-

References
Ye,M., Khoo,K.K., Xu,S., Zhou,M., Boonyalai,N., Perugini,M.A., Chi,C., Galea,C.A., Wang,C. and Norton,R.S. (2012) A Helical Conotoxin From Conus Imperialis Has A Novel Cysteine Framework And Defiines A New Superfamily J Biol Chem 287:14973-14983

Internal links
Proteins Encoded Vi23a precursor

External links
Ncbi
GenBank JQ235207

Tools