Contulakin-G precursor (JP 2011024579-A/2), RNA (N02293) Nucleic Acid Card

General Information
Name Contulakin-G precursor (JP 2011024579-A/2), RNA
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
atgcagacggcctactgggtgatggtgatgatgatggtgt
ggattgcagcccctctgtctgaaggtggtaaactgaacga
tgtaattcggggtttggtgccagacgacataaccccacag
ctcatgttgggaagtctgatttcccgtcgtcaatcggaag
agggtggttcaaatgcaaccaagaaaccctatattctaag
ggccagcgaccaggttgcatctgggcca
tag
Sequence translation MQTAYWVMVMMMVWIAAPLSEGGKLNDVIRGLVPDDITPQ
LMLGSLISRRQSEEGGSNATKKPYILRASDQVASGP

References
Imperial,J., Hillyard,D.R., Watkins,M., Olivera,B.M., Wagstaff,J.D., Jones,R.M., Mccabe,R.T., Cruz,L.J., Layer,R.T., Griffen,D. and Craig,A.G. (2011) Contulakin-G, Analogs Thereof and Uses Therefor Patent: JP 2011024579-A

Internal links
Proteins Encoded contulakin-G precursor

External links
Ncbi
GenBank HV600305

Tools