GeXIVAWT precursor, mRNA, complete cds (N02294) Nucleic Acid Card

General Information
Name GeXIVAWT precursor, mRNA, complete cds
Organism Conus generalis
Organism Diet vermivorous
Organism Clade IX
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgcgtgttgatcatcaccgtgctgttcc
tgacggcctgtcaactcactacagctgtgacttactccag
aggtgagcataagcatcgtgctctgatgtcaactggcaca
aactacaggttgcccaagacgtgccgtagttccggtcgtt
attgtcgctcaccttatgattgccgcagaagatattgcag
acgcattacggatgcgtgcgtatag
Sequence translation MKLTCVLIITVLFLTACQLTTAVTYSRGEHKHRALMSTGT
NYRLPKTCRSSGRYCRSPYDCRRRYCRRITDACV-

References

Internal links
Proteins Encoded GeXIVA precursor

External links
Ncbi
GenBank JX198170

Tools