TxIB precursor gene (N02295) Nucleic Acid Card

General Information
Name TxIB precursor gene
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
tttgatggcaggaatacctcagccaacaacaaagcgactg
acctgatggctctgcctgtcaggggatgctgttccgatcc
tccctgtagaaacaagcacccagatctttgtggcggaaga
cgctga
tgctccaggaccctctgaaccacgac
Sequence translation FDGRNTSANNKATDLMALPVRGCCSDPPCRNKHPDLCGGR
R-

References
Luo,S., Zhangsun,D., Wu,Y., Zhu,X., Hu,Y., McIntyre,M., Christensen,S., Akcan,M., Craik,D.J. and McIntosh,J.M. (2013) Characterization of a novel α-conotoxin from conus textile that selectively targets α6/α3β2β3 nicotinic acetylcholine receptors. J. Biol. Chem. 288:894-902

Internal links
Proteins Encoded TxIB precursor

External links
Ncbi
GenBank HE995411

Tools