De13b precursor cDNA (partial) (N02300) Nucleic Acid Card

General Information
Name De13b precursor cDNA (partial)
Organism Conus delessertii
Organism Diet vermivorous
Organism Clade
Organism Region Western Atlantic and Caribbean
Notes

Sequence
gaccaccagccgcagcgaaaacctactcacggaggagacc
cagccgcagtgaagatcaacccgcagtgaagaccagccag
cagagaagaccaacccgcagagaagaccaacccgtggcaa
cgccgagagcattgaaggaaggaagttgacagacattcga
g
atgtcgggcatgggagtcctgttacttgtgttgctgctt
gtgatgcccctggctgctttccaccaggatggagagggtg
aggcgacgcgaagaagcggtggtctgaaaagagactgccc
aactagctgtccaacgacttgtgccaacggctgggaatgc
tgcaaaggatacccctgtgtccgccaacattgttctgggt
gtaaccatggcaaatag
aacagtggtgttgtatgacagtc
tgtcctgtcacagccaacttcttcgccttctcactagtca
tcataaggccgtgtaggtcttgtttgttttgaaatagcgt
agaaaataaaacttgcaacgacaaagct
Sequence translation MSGMGVLLLVLLLVMPLAAFHQDGEGEATRRSGGLKRDCP
TSCPTTCANGWECCKGYPCVRQHCSGCNHGK-

References
Aguilar,M.B., Ortiz,E., Kaas,Q., López-Vera,E., Becerril,B., Possani,L.D. and de la Cotera,E.P. (2013) Precursor De13.1 from Conus delessertii defines the novel G gene superfamily. Peptides [ahead of print]

Internal links
Proteins Encoded De13b precursor

External links
Ncbi
GenBank KC782513

Tools