Br7.11 precursor, mRNA, complete cds. (N02314) Nucleic Acid Card

General Information
Name Br7.11 precursor, mRNA, complete cds.
Organism Conus brunneus
Organism Diet vermivorous
Organism Clade
Organism Region Eastern Pacific
Notes

Sequence
catcgtcaag
atgaaactgacgtgcatgatgattgttgct
gtgctgttcttgaccgcctggatattcgtcacggctgatg
actccgcaaatggactcgagaatcttcctcagactatacg
tcacgaaatgaagaaccccgaagcctctaaattgaacaag
agagactgccttcctgactacatgctttgtgccttcaata
tgggtctgtgctgcagtgacaagtgcatgctcgtctgcct
ccca
tgatgtcttctactcccctctgtgctacctggcttg
atctttgattggcacgcgcccttcacgggttatgaatccc
tctgattctactctctggacgcctcaggggtccagcatcc
aaataaagcgacatcacgatgggaaaaaagaaaaaaaaaa
aaaaaaaaaaaaaaa
Sequence translation MKLTCMMIVAVLFLTAWIFVTADDSANGLENLPQTIRHEM
KNPEASKLNKRDCLPDYMLCAFNMGLCCSDKCMLVCLP

References

Internal links
Proteins Encoded Br7.11 precursor

External links
Ncbi
GenBank JQ683162

Tools