Im14.1 mRNA, complete cds (N02319) Nucleic Acid Card

General Information
Name Im14.1 mRNA, complete cds
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgccgtctgttcggtctgtgacctgctgctgtctgctgt
ggatgatgttctcggtacagcttgtcactcctggctcccc
tggaactgcacagctgcccagggatcgcactgctagagct
cctgcagagctcattctggaaactatatgccctcacatgt
gtggcataggcatcggggaacccttttgcaactgccgaaa
taaacgtgacgtggtctcttcacggatcatcaggagaaaa
agatccatggcggtg
tgactggacactcacacttccgatg
acgcagacaccattcgctgggactgaaaacctctcttcga
agatcttctctggcctagcattgtcagtccaaaaatattc
caatactcccagagtctgcgaagtcgtgtgatgccctata
tgtactcacgtgtacggtttggtacaccgtgccatgttac
cctacacatcctcaagtctgtgtcttgattttccaccaac
atttcgcctccccatataatgataggtctacgccttgata
tcccatgtccttagtgtatgtcctgataccccatatgtcc
ttcattctatctcctgatgcctcatatctttgtgattaaa
atatgaagagagcaattcaaaaaaaaaaaaaa
Sequence translation MPSVRSVTCCCLLWMMFSVQLVTPGSPGTAQLPRDRTARA
PAELILETICPHMCGIGIGEPFCNCRNKRDVVSSRIIRRK
RSMAV

References

Internal links
Proteins Encoded Im14.1 precursor

External links
Ncbi
GenBank JX000411

Tools