Bt14.1 mRNA, complete cds. (N02320) Nucleic Acid Card

General Information
Name Bt14.1 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgccgtctgttcggtctgtgacctgctgctgtctgctgt
ggatgatgttctctgtacagctcgtcacttctgacttgac
tggaactgcatggctgtctacgcatctcgatgctagaatt
ccttcagaggaaaatatggaagtcctatgccctgaaatgt
gcaacgagggatccggcggggtggcttgcagctgctcaaa
aagacgggacgtggtttcttcattcgtcagaaggcgaaaa
agatcgatggtg
tgactgcatactcacacttccgatgacg
cagacgccattcgctgggactgaaagcctctcttcaaaga
tcttctctggcctagcattgtcagtccaaaaaatatccca
atactcccagagtctgcaaagtcgtaatgccctatatgta
ctcaagtgtatggcttggtacaccatccatgtctgaatac
cccatataccataggtctctctcatgttaccctatgtatc
cccatgtctatgtcttgattttccacccataattcgctac
cccatataatgataggtttacgccttggtaccccatgtcc
ttagtgtatgtcctgataccccataattatgtccttcgct
ctaccctgatgcaccatacctttgtgattaaaatatgaag
agagcaaaaaaaaaaaaaaaaaaaa
Sequence translation MPSVRSVTCCCLLWMMFSVQLVTSDLTGTAWLSTHLDARI
PSEENMEVLCPEMCNEGSGGVACSCSKRRDVVSSFVRRRK
RSMV

References

Internal links
Proteins Encoded Bt14.1 precursor

External links
Ncbi
GenBank JX000412

Tools