Bt14.3 mRNA, complete cds. (N02321) Nucleic Acid Card

General Information
Name Bt14.3 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgccgtctgttcggtctgtgacctgctgctgtctgctgt
ggatgatgttctcggtacagcttgtcactcctggctcccc
tggaactgcacagctgcccagggatcgcactgctagagct
cctgcagagctcattctggaaactatatgccctcacatgt
gtggcacaggcatcggggaacccttttgcaactgccgaaa
taaacgtgacgtggtctcttcacggatcatcaggagaaaa
agatccatggcggtg
tgactggacactcacacttccgatg
acgcagacaccattcgctgggactgaaaacctctcttcaa
agatcttctctggcctagcattgtcagtccaaaaatattc
caatactcccagagtctgcgaagtcgtgtgatgccctata
tgtactcacgtgtacggtttggtacaccgtgccatgttac
cctacacatcctcaagtctgtgtcttgattttccaccaac
atttcgcctccccatataatgataggtctacgccttgata
tcccatgtccttagtgtatgtcctgataccccatatgtcc
ttcattctatctcctgatgcctcatatctttgtgattaaa
atatgaagagagcaaaaaaaaaaaaaa
Sequence translation MPSVRSVTCCCLLWMMFSVQLVTPGSPGTAQLPRDRTARA
PAELILETICPHMCGTGIGEPFCNCRNKRDVVSSRIIRRK
RSMAV

References

Internal links
Proteins Encoded Bt14.3 precursor

External links
Ncbi
GenBank JX000413

Tools