Vi14.1 mRNA, complete cds. (N02322) Nucleic Acid Card

General Information
Name Vi14.1 mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgccgtctgttcggtctgtgacctgctgctgtctgctgt
ggatgatgttctctctcactctcgtcactcctggttcccc
tggacctgcacagctgcctgggcatcgcgctgctagagtt
cctgcagagcagatgatggaagagctatgccctgacatgt
gcaacaggggagaaggggagatcatttgcacctgcgtatt
aagacggcacgtggtttttccatcgatcagagggcgaaaa
agatcgatggcggtg
tgaatgcatactcacacttttgatg
acggcagacaccattcgctgggactgaaagccttttttca
acgattttttatggcctagcattgtcagtccaaaaaatat
cccaatacatattttcaagtgtatgtcttgatgttccacc
cccaattcgcttccccatataatgataggtttacgccttg
atatcccatggccttagtatatgtcctgataccccacatg
tccttcattctgtctcctaaatgcctcatacctttgtgat
taaaatatgaagagagaaaaaaaaaaaaaaaaaaaaaaaa
aaaaaa
Sequence translation MPSVRSVTCCCLLWMMFSLTLVTPGSPGPAQLPGHRAARV
PAEQMMEELCPDMCNRGEGEIICTCVLRRHVVFPSIRGRK
RSMAV

References

Internal links
Proteins Encoded Vi14.1 precursor

External links
Ncbi
GenBank JX000414

Tools