Mr14.2 mRNA, complete cds. (N02326) Nucleic Acid Card

General Information
Name Mr14.2 mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgtatggtgatggttgctgtgctgtttt
ttaccccctggacatttgccccggctgatgacccccgaaa
tggattggagaatctttttccgaaggccccccccgaaatg
aagaaccccgaagcctttaaattgaacaagaggggcccta
acactggtgaattatgtgatggggttgaacaaaactgccg
ctatccctattgctttattgtagtctgccta
taaaactac
cgtgatgttttttactcccctctgtggggcctggcttgat
ttttgattggcgcgtgcccttccccggttatgaacccccc
tgatccgactttcttgcggcctcaggggtttaacatccaa
ataaaggggcagccaaatgaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaaaaaaaaa
Sequence translation MKLTCMVMVAVLFFTPWTFAPADDPRNGLENLFPKAPPEM
KNPEAFKLNKRGPNTGELCDGVEQNCRYPYCFIVVCL

References

Internal links
Proteins Encoded Mr14.2 precursor

External links
Ncbi
GenBank JX000418

Tools