Conus achatinus conotoxin Ac1.1a mRNA, complete cds (N00233) Nucleic Acid Card

General Information
Name Conus achatinus conotoxin Ac1.1a mRNA, complete cds
Organism Conus achatinus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccctgtttctgttggttg
tcttgacaaccactgtcgtttcctacccttcagatagtgc
atctgatggcagggatgacgaagccaaagacgaaaggtct
gacatgtacgaattgaaacggaatggacgctgttgccatc
ctgcctgtggcaaacactttaattgtggacgc
tgatgctc
caggaccctctgaaccacgac
Sequence translation MGMRMMFTLFLLVVLTTTVVSYPSDSASDGRDDEAKDERS
DMYELKRNGRCCHPACGKHFNCGR

References
Yuan,D.D., Han,Y.H., Wang,C.G. and Chi,C.W. (2007) From the identification of gene organization of alpha conotoxins to the cloning of novel toxins Toxicon 49:1135-1149

Internal links
Proteins Encoded Ac1.1a precursor

External links
Ncbi
GenBank DQ359138

Tools