Conus betulinus conotoxin Bt6.2 mRNA, complete cds. (N02330) Nucleic Acid Card

General Information
Name Conus betulinus conotoxin Bt6.2 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgtcaaaactgggagtcgtgctgttcctgacggcctgtc
aactcattacacctgattcctccagagataagcaggagga
tcctgtagtgaggtcgagtgataaggtgcagagatccaag
caccgcaagttggccaagagatgctcagaagtcggtgccg
cgtgtgatactgagagtaatatctgctgcagtggagaatg
ctttgccgtgcaaggctcaacatttggcatatgcgag
tga
cgtctgatgttttcccctctgtccttcatccccttttgct
tgattcatccatacctatgtgtggccatgaaccactctct
accttaacccctggtggcttcagaggacgtatatcaaaat
aaaaccgcactgcaaaaaaaaaaaaaa
Sequence translation MSKLGVVLFLTACQLITPDSSRDKQEDPVVRSSDKVQRSK
HRKLAKRCSEVGAACDTESNICCSGECFAVQGSTFGICE

References

Internal links
Proteins Encoded Bt6.2 precursor

External links
Ncbi
GenBank JX000422

Tools