Mr6.11 mRNA, complete cds. (N02331) Nucleic Acid Card

General Information
Name Mr6.11 mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgtcaaaactgggagtcgtgctgttcctgacggcctgtc
agctcctaacagctgataactccagagataagcaggagta
ccctacaatgaggttcagagaccaaatgcggaatgccaaa
ggtcccaagtggatccgttcatgcgcgcagagcggtctaa
gttgtgataccagaccttgctgcgatgataaaccatgtgt
tccaaacgggagacaaagcatgtgtggcggc
taatattcc
ctactgtgctctgccttcctttgtttgattcatccatacc
tatgtgtggtcatgaaccagacggtaccttcacctctggc
ggcttcagaggaagtgtatcaaaataaaaccactttgcaa
tgaaaaaaaaaaaaaa
Sequence translation MSKLGVVLFLTACQLLTADNSRDKQEYPTMRFRDQMRNAK
GPKWIRSCAQSGLSCDTRPCCDDKPCVPNGRQSMCGG

References

Internal links
Proteins Encoded Mr6.11 precursor

External links
Ncbi
GenBank JX000423

Tools