Mr6.10 mRNA, complete cds. (N02333) Nucleic Acid Card

General Information
Name Mr6.10 mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgtcaaaactgggagtcgtgctgttcctgacggcctgtc
aactcaccacagctgatctctccagtgatgagtaccatgc
agtgaggtcgatagacgaaatgcacgatttcaaaggttcc
agggcgacaccggaatgctcgagggctggttgtaaaaatg
ttccttgctgctctggtttgaaatgcacaggcccccaaaa
tggacccgtatgccaaccggaa
tgatatttcccccctgtg
ctttgcccttttttgcctgattgatccatacctaaggggg
gtcatgaaccactcagtacctacacctttgatggcttgag
aggacgtatatcaaaataaaatcacattgcaatgaaaaaa
aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation MSKLGVVLFLTACQLTTADLSSDEYHAVRSIDEMHDFKGS
RATPECSRAGCKNVPCCSGLKCTGPQNGPVCQPE

References

Internal links
Proteins Encoded Mr6.10 precursor

External links
Ncbi
GenBank JX000425

Tools