Di001 (precursor 4) mRNA, complete cds. (N02334) Nucleic Acid Card

General Information
Name Di001 (precursor 4) mRNA, complete cds.
Organism Conus distans
Organism Diet vermivorous
Organism Clade Early
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaaatgggagtggtgctattcacctttctggtcc
tgtttcccctggcaactcttcagctggatggagaccaatc
cgctgatcatcaagcagagaaaagggaccaggatcaaagc
agacagaatggaaacttgaagcgtgctctgaaaagggatg
tgaaatgcattggttcatgcgactctaccgtctggcatcg
tgtc
tgaaaggcatcaggctgattactccaaaacagtggt
cgtctaatgactgaattatatgatcactatagggaataaa
cttttcccaagaaaaaaaaaaa
Sequence translation MLKMGVVLFTFLVLFPLATLQLDGDQSADHQAEKRDQDQS
RQNGNLKRALKRDVKCIGSCDSTVWHRV

References

Internal links
Proteins Encoded Di001 precursor

External links
Ncbi
GenBank JX000426

Tools