Mr106 (precursor 6) mRNA, complete cds. (N02336) Nucleic Acid Card

General Information
Name Mr106 (precursor 6) mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgtcaaaactgggagtcgtgctgttcatctttctggttc
tgtttcccatggcaactcttcagctggatggagaccaatc
cgctgatcatcaagcagacaaaagggaccaggatcaaagc
agacagaatggaaacttgaagcgtgctctgaaaagggatg
tgagatgcattggttcatgcgactctaccgtctggcatcg
tgtc
tgaaaggcatcaggctgattactccaaaacagtggt
cgtctaatgactgaattatatgatcactatagggaataaa
cttttcccaagaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
cccaaaaaaaaaa
Sequence translation MSKLGVVLFIFLVLFPMATLQLDGDQSADHQADKRDQDQS
RQNGNLKRALKRDVRCIGSCDSTVWHRV

References

Internal links
Proteins Encoded Mr106 precursor

External links
Ncbi
GenBank JX000428

Tools