Vi 001 (precursor 7) mRNA, complete cds. (N02337) Nucleic Acid Card

General Information
Name Vi 001 (precursor 7) mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgtcaaaactgggagtcgtgctgttcatctttctggttc
tgtttcccatggcaacacttcagctggatggagatcaacc
cgctgatcgtcgtgcagatgaaaaggacctaacacaacag
tatctaaacttgaggcgtgttctgcaaaggggtttggtat
gcgctcatgtgagtccatcccaaaatagctggtggacg
tg
aggcatcaggctgattactccagaacagtggtcgtctaat
gattgaattataagatcactacagggaataaaagtttccc
aagaaaaaaaaaaaaaaaaaaa
Sequence translation MSKLGVVLFIFLVLFPMATLQLDGDQPADRRADEKDLTQQ
YLNLRRVLQRGLVCAHVSPSQNSWWT

References

Internal links
Proteins Encoded Vi001 precursor

External links
Ncbi
GenBank JX000429

Tools