Im9.13 mRNA, complete cds. (N02340) Nucleic Acid Card

General Information
Name Im9.13 mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaagtgggagttgtacttcttatatttctggttc
ttatgtcatcggcaatcccccaagacagggatttttcagg
acagcaaagtgacaagaagcaaattcgtcagagggacatc
tttgggagtaaaatgagaagatacagtccgaacatccaaa
gacgttgcattgtgggcacaccctgccatgtgtgcagaag
ccaatctaaaagttgcaatgggtggctcgaaaaacaaaga
tactgcggatattgtggt
tgacgaagaagacagaacatca
ctgattaacccctaaacaagcagcatcagcatgatctgtt
gatcacaaaaacaaaaaaaaaaaa
Sequence translation MLKVGVVLLIFLVLMSSAIPQDRDFSGQQSDKKQIRQRDI
FGSKMRRYSPNIQRRCIVGTPCHVCRSQSKSCNGWLEKQR
YCGYCG

References

Internal links
Proteins Encoded Im9.13 precursor

External links
Ncbi
GenBank JX000451

Tools