Conomarphin-Bt3 mRNA, complete cds. (N02343) Nucleic Acid Card

General Information
Name Conomarphin-Bt3 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgttgaaagtgggagttgtgttgtgcatctttctgattc
tgtttcccatggcaactcttcagctggatggagatcaaac
cgctgatcgtcatgcagacgaaagggaccaggacctagca
gaacagtatcgaaacttgaagcgtgttctgaaaaggggct
gggtataccatgcacatccagatgccaatagctggtggtc
ccttgtt
tgagaggcatcaggctggttactccagaacaga
ggtcatctaatgattgaattaaaagatcactacagggaat
aaaagtttcccaagaaaaaaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation MLKVGVVLCIFLILFPMATLQLDGDQTADRHADERDQDLA
EQYRNLKRVLKRGWVYHAHPDANSWWSLV

References

Internal links
Proteins Encoded Conomarphin-Bt3 precursor

External links
Ncbi
GenBank JX000455

Tools