Contryphan-Bt1 mRNA, complete cds. (N02345) Nucleic Acid Card

General Information
Name Contryphan-Bt1 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctggttcttgttgctgctgcac
tgttgtcgacccaggtcatggttcaaggcgacggagatca
cctggcagatcgagatgcagtgccaagagacgataaccca
ggtggaacacgtgaaaagattatgaatgctctacgtcggt
ttggatgtccgccgggtctttggtgtggc
tgatcggaatc
tacgattgctatgacaaccaacagtgccgcactcgaatta
ccctacagtggtctggttgctccagaacaatgatgttttg
aaaaccgtattcgttgccgcggccatttttgttgtgttgt
aattaaataaaacgatgacagtctcgtttacaaaaaaaaa
aaaaaaaa
Sequence translation MEKLTILVLVAAALLSTQVMVQGDGDHLADRDAVPRDDNP
GGTREKIMNALRRFGCPPGLWCG

References

Internal links
Proteins Encoded Contryphan-Bt1 precursor

External links
Ncbi
GenBank JX000457

Tools