Di6.10 mRNA, complete cds. (N02349) Nucleic Acid Card

General Information
Name Di6.10 mRNA, complete cds.
Organism Conus distans
Organism Diet vermivorous
Organism Clade Early
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctgcttcttgttgctgccgtgc
tgttgtccacccaggtcctggttcaaggcgatggagaaaa
atcccagaagaggatggacctgctcaaaggaagaatgtta
tcaggaaatctgaacaaacgttgcgatacctggagagacc
cttgtacctacgaacatgaatgctgttggcagtatcactg
tggattccgtacgtgcgaa
tagtagatgcaacgaactctg
accacaagccatcaccactctcatcttcggaggcttcaaa
tgttttgggggagaaagcagttgagtagtcaagcatgttt
tttccctttgcaaaatcaaggatggaggttaaaagcctct
catgtagtcttcatcaataaagaacttactatcacaagaa
aaaaaaaaa
Sequence translation MEKLTILLLVAAVLLSTQVLVQGDGEKSQKRMDLLKGRML
SGNLNKRCDTWRDPCTYEHECCWQYHCGFRTCE

References

Internal links
Proteins Encoded Di6.10 precursor

External links
Ncbi
GenBank JX018175

Tools