Cal12.1.1b mRNA, complete cds (N00235) Nucleic Acid Card

General Information
Name Cal12.1.1b mRNA, complete cds
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgtgcgtgctggtcgttcttctcctgcttc
tgccgtatggtgacctcatcaccaataattacatcagagg
ggcagccagaaaggtcacaccatggcggaggaacttgaaa
actcgggacgtctgcgattcgctggtaggcggacactgta
tccacaatggctgttggtgtgaccaagatgcacctcatgg
caattgctgcgacactgacggttgtactgcggcctggtgg
tgtcccgggaccaaatgggac
taa
Sequence translation MKLTCVLVVLLLLLPYGDLITNNYIRGAARKVTPWRRNLK
TRDVCDSLVGGHCIHNGCWCDQDAPHGNCCDTDGCTAAWW
CPGTKWD

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Proteins Encoded Cal12.1.1b precursor

External links
Ncbi
GenBank EF644175

Tools