Di8.1 mRNA, complete cds. (N02352) Nucleic Acid Card

General Information
Name Di8.1 mRNA, complete cds.
Organism Conus distans
Organism Diet vermivorous
Organism Clade Early
Organism Region Indo-Pacific
Notes

Sequence
atgatgttgaaaatgggagctatgtttgtccttttgcttc
tttgctcgttcacgtttacaaatatcaaggcacggagaac
attctggaagcgcgatctttatggtgatctggcagggcgt
tccagctgcagtggcacttgttatgacagtgccaattgtg
acggtacttgctattgccgagaggataattgttggtgcac
tggcgatttatcatgcgcttgtcaatgcgca
tgataactt
gactctttttgctcgtttaacgattgagaaaaaaatccag
agcaatatgctgcagaaaaaccgaagactctgagacttcc
tcataataaatctgtgaagacaaaaaaaaaaa
Sequence translation MMLKMGAMFVLLLLCSFTFTNIKARRTFWKRDLYGDLAGR
SSCSGTCYDSANCDGTCYCREDNCWCTGDLSCACQCA

References

Internal links
Proteins Encoded Di8.1 precursor

External links
Ncbi
GenBank JX018178

Tools