Vi6.9 mRNA, complete cds. (N02354) Nucleic Acid Card

General Information
Name Vi6.9 mRNA, complete cds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgtatggtgatcatcactgtgctgttcc
tgacggccagtcagctcattacagctgattactccagaga
tcagcggcagtaccgtgcagtgaggttgggagatgaaatg
cggaatttcaaaggtgccagggactgcgggggacaaggtg
aaggttgttatactcaaccttgctgccctggtctgcggtg
ccgtggcggcggtactggaggaggctcatgccagcca
tag
taatagtctggcatctgatatttcccctctgtgctccacc
ctcttttgcctgattcatccttacctatgtgtggtcatga
accactcagtagctacacctctggtggattcagagaacgt
atatcaaaataaaaccacattgcaatgacaaaaaaaaaaa
aaaa
Sequence translation MKLTCMVIITVLFLTASQLITADYSRDQRQYRAVRLGDEM
RNFKGARDCGGQGEGCYTQPCCPGLRCRGGGTGGGSCQP

References

Internal links
Proteins Encoded Vi6.9 precursor

External links
Ncbi
GenBank JX000432

Tools