Im6.1 mRNA, complete cds. (N02355) Nucleic Acid Card

General Information
Name Im6.1 mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgtatggtgatcgtcgccgtgctgctcc
tgacggcctgtcaactcaatacggctgatggttccagaga
taagcaagaggatcgtttggtgaaattgttcaacaagagg
tggaattctccagactccaggttgaccaggaagtgccaac
caaacggctattattgcgattttgagtttacaccaaaatg
ctgcttaaagtgcgactacaacaggaagtattgccaacct
tat
tagctagtctgacatctgttgtttccccctctgtgct
ctaccctcttttgcccgattcatccctgcctgtgagcggt
cctaaaccactcagaacatactcttcttgttgcttcagaa
gatgtatattaaaataaaagcacattgcaaggaaaaaaaa
aaaaaaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation MKLTCMVIVAVLLLTACQLNTADGSRDKQEDRLVKLFNKR
WNSPDSRLTRKCQPNGYYCDFEFTPKCCLKCDYNRKYCQP
Y

References

Internal links
Proteins Encoded Im6.1 precursor

External links
Ncbi
GenBank JX000433

Tools