Bt6.4 mRNA, complete cds. (N02360) Nucleic Acid Card

General Information
Name Bt6.4 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgtatggtgatcgttgccgtgctgttct
tgaccgcctggacatccgtcatggctgatggctccataaa
tagaccggatattgccgaaggatggcaaaaatttttctcg
aaggcacgtgacgaaatgaagaaccgcgcagcctctgaat
taaacaagaggtgcgctggtattggttcgttttgtggcct
accaggcctagtggattgctgcagtgggaggtgcttcatc
gtttgcttgccg
tgatgtcttcgactcccctctgtgctac
ctggctttatctttgattggcgcgtgcccttcatttgtta
cgacccctctgatcctactctctgaagacctctggggtcc
aacatccaaataaagcgacatcccaaaaaaaaaaaaaaaa
Sequence translation MKLTCMVIVAVLFLTAWTSVMADGSINRPDIAEGWQKFFS
KARDEMKNRAASELNKRCAGIGSFCGLPGLVDCCSGRCFI
VCLP

References

Internal links
Proteins Encoded Bt6.4 precursor

External links
Ncbi
GenBank JX000438

Tools