Im6.5 mRNA, complete cds. (N02364) Nucleic Acid Card

General Information
Name Im6.5 mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctgcttcttgttgctgctgtac
tggtatcgacccaggcgctgattcaaggaggagaaaaacg
gcaaaaggcaatgatcaactttttatcaaaaagaaagcca
tctgctaagcgttggtggggggacgaaagatgcacttatt
ggttgggaccttgtatcgtggactcggaatgttgttctaa
tagctgtgaggaaaggttctgcgggttgtgg
tgacgaact
cagaccacaagccatccgacatcaccactctcctcttcag
aggtttctaggcttttgttctccatttgaataatctttac
gactaaacaaataagtatactagcacattttttttcgttt
ccaaattcaattatggaggtaaaaagcctcacattctgtc
ttcatcaataaagaacttatcatcataataataaaaaaaa
aaaaaaaaaaaaaaa
Sequence translation MEKLTILLLVAAVLVSTQALIQGGEKRQKAMINFLSKRKP
SAKRWWGDERCTYWLGPCIVDSECCSNSCEERFCGLW

References

Internal links
Proteins Encoded Im6.5 precursor

External links
Ncbi
GenBank JX000442

Tools