Im16.1 (Im6.6) mRNA, complete cds. (N02365) Nucleic Acid Card

General Information
Name Im16.1 (Im6.6) mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctgcttctggttactgcggtac
tgatgtcgactcaggccctgatgcaaagtggtatagaaaa
acgccaaagagcgaagatcaaatttttttcgaaaagaaag
acaactgttgagagatggtgggagggcgaatgctatgatt
ggttaaggcaatgttcgtcgcctgcacaatgttgttctgg
caattgtggcgcccactccaaggcgggg
tgatgaactctg
accccaagccatccgacatccccactttcctcttcagggg
cttcaaggcttttgttttccgtttgaagaatttttacgtg
taaacaaataagtagactagcacgtttttttccctttgca
aaatcaattatggaggtaaaaagcctcccattttgttttc
atcaataaagaacttatcatcacaatattcaaaaaaaaaa
aaaaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation MEKLTILLLVTAVLMSTQALMQSGIEKRQRAKIKFFSKRK
TTVERWWEGECYDWLRQCSSPAQCCSGNCGAHSKAG

References

Internal links
Proteins Encoded Im16.1 precursor

External links
Ncbi
GenBank JX000443

Tools