Di15.1 (Di6.5) mRNA, complete cds. (N02366) Nucleic Acid Card

General Information
Name Di15.1 (Di6.5) mRNA, complete cds.
Organism Conus distans
Organism Diet vermivorous
Organism Clade Early
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctgattcttgttgccactgcac
tgttgtcgatccaggtcatggttcgaggtgacggagaaaa
gcctctgatggggaggatcaaacgaaatgctgctgccggt
ctctcggctctcattagagggaaacgctgcaaaggagcca
gcgctctttgtgaggaggatggcgagtgctgcagtggcga
ctgtaaatgcatgcatgcttctggctgcacaaacgatatt
aatcttaggtgtgcagct
taggtcatccagcattaccact
ctcctcttcacaggctttaggcctttcgaacatttttatt
tatcagtaaacaattaaggaaggaaacatttcccctcggc
atatctagagataaaattaaaaatgcacccactttgtctt
cattaataaagaacttactatttcaaaaaaaaaaaaaaa
Sequence translation MEKLTILILVATALLSIQVMVRGDGEKPLMGRIKRNAAAG
LSALIRGKRCKGASALCEEDGECCSGDCKCMHASGCTNDI
NLRCAA

References

Internal links
Proteins Encoded Di15.1 precursor

External links
Ncbi
GenBank JX000444

Tools