Bt6.3 mRNA, complete cds. (N02368) Nucleic Acid Card

General Information
Name Bt6.3 mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctgattcttcttgctgctgtac
tggtgttggcccaggccctgattaaaggtggtggagaaaa
acgccaaaaggaaaagatcaactttttatcaaaaagaaag
acaactgctgagagttggtgggagggcgaatgcagcggtt
ggtccgtgtattgtacgtgggactcggaatgttgttctgg
tgaatgtaccagatcttactgcgaattgtgg
tgatgaact
ctgaccagaagccatccgacaccaccattcttctcttcag
aggcttcaaggcttttggtcaacttttgaagaatcttcac
aagtaaacaaataagtagactagcacgttttctccctttg
caaaatcaatgatggaagtaaaaagcctcacatgttgtct
tcatcaataaagaacttctcatcatgataaaataaaaaaa
aaaaaaaaaaa
Sequence translation MEKLTILILLAAVLVLAQALIKGGGEKRQKEKINFLSKRK
TTAESWWEGECSGWSVYCTWDSECCSGECTRSYCELW

References

Internal links
Proteins Encoded Bt6.3 precursor

External links
Ncbi
GenBank JX000446

Tools