Conus flavidus A-conotoxin peptide precursor Fla6.1 (Fla6.1) mRNA, partial cds. (N02373) Nucleic Acid Card

General Information
Name Conus flavidus A-conotoxin peptide precursor Fla6.1 (Fla6.1) mRNA, partial cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgggcaaacggatggtgttaaccatgtttctgttggttg
tcttggcaaccactgtggtttctttcacgttagatcatgc
atctgatagcaggggtaccgcagccaacgacaaagcgact
gaccagatggctctggccgtcaggcttgattggtgtgacg
atgccgactttctcgtggatcatccagagctttgtggctg
ggacgtatgctgtgcctatcctccctgtagacacaaacac
caagattgtaatcagggacgc
Sequence translation MGKRMVLTMFLLVVLATTVVSFTLDHASDSRGTAANDKAT
DQMALAVRLDWCDDADFLVDHPELCGWDVCCAYPPCRHKH
QDCNQGR

References

Internal links
Proteins Encoded Fla6.1 precursor

External links
Ncbi
GenBank JX499135, JX499073

Tools