Conus flavidus A-conotoxin peptide precursor Fla1.1 (Fla1.1) mRNA, complete cds. (N02374) Nucleic Acid Card

General Information
Name Conus flavidus A-conotoxin peptide precursor Fla1.1 (Fla1.1) mRNA, complete cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
ggggacaacttggtacaaaaaagttggcatctgcgaacca
gacggacgtgaaacagcatcaccggcaagtggggacagtg
caagacacgtagaacagggtagcagagagtctgcgataac
aacc
atgggcatgcggatgatattcactgtgtttctgttg
gttgccttggcaaccactgtcgcttccttcactttagatc
gtgcatctaatggcaggaatgctgcagctgacaacaaacc
gtctgactggatcgctttggccatcaagcaatgctgccgc
aatccaaaatgtagccagcagggttgtccataa
tcaggaa
agcaaacaacaaagaactgctcgagaagtttaggttatag
atagggtaaggggaaaaacaaacgtctgggaaatgatgaa
aacggtaaataaaagaaagaaacaatacatacttgtttca
tggttgatgatttttgttgttgaataacccgtgtggacat
taatggtagtctctcctcactccatgccattagatttttt
ctttctttatccaagatttgctgaatattttagcctagtt
atagacattgcaatatatatatatatatatatatatatat
atatatatatatatatatatatatatatatatatatatat
atatatatatatatatctatccatcggcaccat
Sequence translation MGMRMIFTVFLLVALATTVASFTLDRASNGRNAAADNKPS
DWIALAIKQCCRNPKCSQQGCP-

References

Internal links
Proteins Encoded Fla1.1 precursor

External links
Ncbi
GenBank JX499074

Tools