Conus flavidus A-conotoxin peptide precursor Fla1.8 (Fla1.8) mRNA, complete cds. (N02381) Nucleic Acid Card

General Information
Name Conus flavidus A-conotoxin peptide precursor Fla1.8 (Fla1.8) mRNA, complete cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
agctgcggaccagacggacgtgaaacagcatcgccgacaa
gtggggatagtacaaggcacgcagaacaaagagtgtctga
gaaattaatc
atgggcatgaggatgatgttaacagtgttt
ctgttggttgtcttggcaaccactgtggtttccgatcatg
catctgatggcaggaataccgcagccaaagtcaaatattc
taaaacgcaggaggaatgctgtcccaatcctccctgtttc
gcggtaaattcggctctttgtggcgcaagacgttga
tgct
ccaggaccctctgaaccacagcatgccgccctctgcctga
cctgcttcactttctgtctctttgtgccactagaactgaa
caacttgatccactagctcccacattacctccatattctg
aaactacttggatttgattgtctttaatttctagtcacac
ctgctgtcattacatcatataaatgtaaacaagaacatga
ggagtgggtgtctgttcaaacaaaaccaggcaatgacaag
ggaaaaaagtctcagatctatttgaaaactgtcacccgtc
attttcttaaccagttttagaactgattaccaatagagct
tttgtaccacataaaatcaggtctttgtgtaatgtttctt
ttacaaacgtcgatgaaattcttgagaaaaaaaaaatgct
caaaatgtgggaagcacttttggttgtctgacaacttgtg
atcatgtctctttccagtgagtctcactgcgatctctgtt
gtgtgtttttcatcacctgttaagcaacgcaagaggttgt
ccataatcaggaaagcaaaagacaaagaactgctcaagat
ttcaggaaatagatagggcaggggaaaaacaga
Sequence translation MGMRMMLTVFLLVVLATTVVSDHASDGRNTAAKVKYSKTQ
EECCPNPPCFAVNSALCGARR-

References

Internal links
Proteins Encoded Fla1.8 precursor

External links
Ncbi
GenBank JX499081

Tools