Conus flavidus O1-conotoxin peptide precursor Fla-17 (Fla-17) mRNA, complete cds. (N02386) Nucleic Acid Card

General Information
Name Conus flavidus O1-conotoxin peptide precursor Fla-17 (Fla-17) mRNA, complete cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
gcacggtgaatttggcttcatatttctccgctgttttcct
tcgcatcacccaaaacatcaccaag
atgaaactgacgtgc
atactgatcgttgctgtgctgttctcgaccgcctggacat
tcgtcacagttgatgactcgataaatcacctgaagtacag
agaatggaccgattttaggccatggggaaaacgaattccg
gaggcacgtgacaaaatgaagaacctcaaattctctaaat
tggacaataagaaaaggcgtctctga
agtgatgaagtttg
tgtcgtaccgctcattgcatccttcgaatgctgcagtggc
ttatgtgttggcgtctgcgcctcgttaaactgccgtgatg
tcttctactctcttctgtgctacccctggtttgatctttg
atcagcgtgtgcccttcactggttatgaacccctctgatc
ctactctctggtgacctctgtggtccaacatccaaataaa
gcgacatccc
Sequence translation MKLTCILIVAVLFSTAWTFVTVDDSINHLKYREWTDFRPW
GKRIPEARDKMKNLKFSKLDNKKRRL-

References

Internal links
Proteins Encoded Fla-17 precursor

External links
Ncbi
GenBank JX499090

Tools