Conus flavidus M-conotoxin peptide precursor Fla-15 (Fla-15) mRNA, partial cds. (N02389) Nucleic Acid Card

General Information
Name Conus flavidus M-conotoxin peptide precursor Fla-15 (Fla-15) mRNA, partial cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgttgaaaatgggagtgatgctattcacctttctggtcc
tgtttcacctggcagcgccccagctggatgcagatcaacc
tgtagcacgatatgcggggaataaaccggacttcaaccca
aataaaaggatgaaaatgatgtctgctctgaggaagcgcg
gatgctgtccacctagtttgtgcgacccaggttgtgacga
agggtgctgccccgtagtaacgcccgcttgt
Sequence translation MLKMGVMLFTFLVLFHLAAPQLDADQPVARYAGNKPDFNP
NKRMKMMSALRKRGCCPPSLCDPGCDEGCCPVVTPAC

References

Internal links
Proteins Encoded Fla-15 precursor

External links
Ncbi
GenBank JX499095

Tools