Conus flavidus A-conotoxin peptide precursor Fla1.5 (Fla1.5) mRNA, complete cds. (N02392) Nucleic Acid Card

General Information
Name Conus flavidus A-conotoxin peptide precursor Fla1.5 (Fla1.5) mRNA, complete cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
cacc
atgcttctgttggttgtcttggcaaccactgtcgtt
tccttcacgttagatcatgcatttgatggcaggaataccg
cagccaacaacaaagcgactgacctgatggctctgcctgt
caggggatgctgttccgatcctccctgtagacacaagcac
caagatctttgtggc
tgaagacgctgatgctccaggaccc
tctgagccacgacatgctgccctctgcctggcctgcttca
ctttccgtctctttgtgccactagaactgaacaacttgat
ccactagactcccacgtttccttcgtactctgaaactact
cggatttgattgtctctaatttctagtcacacttgctgtc
attacatcatataaatttaaacaagaacatgaggggtgtc
tgttcaaacaaaaccaggcaatgacaagggaaaaagtctc
cgatctatttgaaaactgtcacccgtcattctcttaacca
gttttagaactgattaccaatagagcttttgtaccgcata
aattcaggtctttgtgtaatgtttcttttacaaacgtcga
tgaaattcttgggaaaaaaaaagctgaaatgtgggaagca
cttttggttgtctgacaacttgtgatcatgtctctttcca
gtgagtctcactgtgatctctgttgtgtgtttttcatcac
ctgttaagcaacgcaaagaggttgtccataatcaggaaag
caaaagacaaagaactgctcaagaatttcaggaatagata
gggcaggggaaaaacagacctatgggaaatgataaaacaa
cagataaaagaaattgaacattacctacttgtttcatggt
tgatgacttat
Sequence translation MLLLVVLATTVVSFTLDHAFDGRNTAANNKATDLMALPVR
GCCSDPPCRHKHQDLCG

References

Internal links
Proteins Encoded Fla1.3 precursor

External links
Ncbi
GenBank JX499099

Tools