Conus flavidus M-conotoxin peptide precursor Fla3.5 (Fla3.5) mRNA, partial cds. (N02395) Nucleic Acid Card

General Information
Name Conus flavidus M-conotoxin peptide precursor Fla3.5 (Fla3.5) mRNA, partial cds.
Organism Conus flavidus
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccgtctgtctgc
ttctgtttccccttactgctcttcggctggttagagatca
acctgcagagcgacctgcaaagcgtacgcaggacgacatt
ccaaatggacaggatccgttaattgataggcagataaatt
gttgcccttggccatgccctgattcatgccactatcaatg
ctgccac
Sequence translation MMSKLGVLLTVCLLLFPLTALRLVRDQPAERPAKRTQDDI
PNGQDPLIDRQINCCPWPCPDSCHYQCCH

References

Internal links
Proteins Encoded Fla3.5 precursor

External links
Ncbi
GenBank JX499104

Tools