Conus coronatus A superfamily conotoxin Co1.2 precursor, mRNA, complete cds. (N02398) Nucleic Acid Card

General Information
Name Conus coronatus A superfamily conotoxin Co1.2 precursor, mRNA, complete cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtatttctgttggttg
tcttggcaaccgctgtggtttcctccacttcagatcgtgc
atctgatggcaggaataccgcatccaaagtgtttgacctg
atcgctctgaccgccagagaagattgctgtttcattgatg
actgttgggcgagtcatccagaagcttgtggaggaggaat
ggaacttctacgccaggaccctctgaaccgcgacatgccg
ccctctgcctga
Sequence translation MGMRMMFTVFLLVVLATAVVSSTSDRASDGRNTASKVFDL
IALTAREDCCFIDDCWASHPEACGGGMELLRQDPLNRDMP
PSA-

References

Internal links
Proteins Encoded Co1.2 precursor

External links
Ncbi
GenBank JX293411

Tools