Conus tessulatus TsMMSK-022 conotoxin scaffold III/IV precursor, mRNA, complete cds (N00024) Nucleic Acid Card

General Information
Name Conus tessulatus TsMMSK-022 conotoxin scaffold III/IV precursor, mRNA, complete cds
Organism Conus tessulatus
Organism Diet vermivorous
Organism Clade XVI
Organism Region Indo-Pacific
Notes

Sequence
ggatcgatagcagttc
atgatgtctaaactgggagtcttg
ttgaccatctgtctgcttctgtttccccttactgctgttc
cgctggatggagatcaacatgcagaccgacctgcagatcg
tatgcaggacatttcatctgaacagcatcccttgtttgat
cccgtcaaacggtgttgcgattggccatgcaccataggat
gcgtcccttgttgcttgcct
taataacgtgtggatgacca
Sequence translation MMSKLGVLLTICLLLFPLTAVPLDGDQHADRPADRMQDIS
SEQHPLFDPVKRCCDWPCTIGCVPCCLP

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded TsMMSK-021 precursor

External links
Ncbi
GenBank AF214924

Tools