Conus coronatus A superfamily conotoxin Co1.7 precursor, mRNA, complete cds. (N02403) Nucleic Acid Card

General Information
Name Conus coronatus A superfamily conotoxin Co1.7 precursor, mRNA, complete cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
tcttggcaaccgctgccgtttccttcacttcagatcgtgc
atatgatggcgggaatgacgcagccaaagcgtttgactgg
atcgctctgaccgccagacacgaatgctgttcctatcctg
cctgtgcgtatactcatccagaactttgtggtggaagacg
ctga
Sequence translation MGMRMMFTVFLLVVLATAAVSFTSDRAYDGGNDAAKAFDW
IALTARHECCSYPACAYTHPELCGGRR-

References

Internal links
Proteins Encoded Co1.7 precursor

External links
Ncbi
GenBank JX293416

Tools