Conus caracteristicus A superfamily conotoxin Ca1.3 precursor, mRNA, complete cds. (N02413) Nucleic Acid Card

General Information
Name Conus caracteristicus A superfamily conotoxin Ca1.3 precursor, mRNA, complete cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
ccttggcaaccactgtcgttcccttcacttcagatcgtgc
atctgctagcaggaatgccgcaaccgacaacaaagcatct
gagctgaaagctctgaacgccaggataccatgctgttcct
atcctgcttgtgcccagagtaatatagacctttgtggtgg
aagacgctga
Sequence translation MGMRMMFTVFLLVALATTVVPFTSDRASASRNAATDNKAS
ELKALNARIPCCSYPACAQSNIDLCGGRR-

References

Internal links
Proteins Encoded Ca1.3 precursor

External links
Ncbi
GenBank JX293426

Tools